PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G230200.1.p
Common NameSb10g027280, SORBIDRAFT_10g027280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 429aa    MW: 45764.2 Da    PI: 7.1851
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G230200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.2e-172774148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+ Ed+llvd v+++G g+W+t+ r+ g+ R++k+c++rw ++l
  Sobic.010G230200.1.p 27 KGPWTQAEDKLLVDHVRRHGEGNWNTVRRETGLLRCGKSCRLRWANHL 74
                          79******************************99**********9986 PP

2Myb_DNA-binding42.51.5e-1380123146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           +g++++eE+  ++ ++ + G++ W++I+++++ gRt++++k++w++
  Sobic.010G230200.1.p  80 KGPFSPEEERHILILHGLNGNK-WAKISSYLP-GRTDNEIKNYWNT 123
                           79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5962274IPR017930Myb domain
SuperFamilySSF466891.11E-2925121IPR009057Homeodomain-like
SMARTSM007171.6E-132676IPR001005SANT/Myb domain
PfamPF002491.1E-142774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-212881IPR009057Homeodomain-like
CDDcd001671.46E-112974No hitNo description
PROSITE patternPS0017504251IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.29475129IPR017930Myb domain
SMARTSM007171.4E-1279127IPR001005SANT/Myb domain
PfamPF002496.9E-1380123IPR001005SANT/Myb domain
CDDcd001673.67E-982125No hitNo description
Gene3DG3DSA:1.10.10.606.3E-2382128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MARSGGGGSV GVEGGGGGGT GGGGLRKGPW TQAEDKLLVD HVRRHGEGNW NTVRRETGLL  60
RCGKSCRLRW ANHLRPNLRK GPFSPEEERH ILILHGLNGN KWAKISSYLP GRTDNEIKNY  120
WNTRLKRRQR AGLPLYPPDV ERDIAILRAQ NADADANAHA NANASLPPPP PLLYDASNPF  180
VALPPTMPSP SPTHSPLQIN QNYPLLNQMQ VFHHIGGSHH QQQQQPQPAF HQDNGSAAAA  240
FGSGIVSSGL PPLPTATARA QQLELPSNQQ FDTSSSGSGS GSVGLLESML IGDEHLMLRP  300
NPSMVKVPSM PALSYREPAG SRLLPAHGVG SDGDVTSHAH ALCPPGEDIH HGATWDFTFE  360
AVKPAKRRTA SEVGISDMFA IAPAGDWFGT CGGSTGPSSA VTDDEFNLEM QQFMSLLPLS  420
IDEHGCNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28251285107B-MYB
1h8a_C8e-282512825127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.209350.0ovary| pollen
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387231e-139BT038723.1 Zea mays full-length cDNA clone ZM_BFb0313M23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438857.10.0hypothetical protein SORBIDRAFT_10g027280
TrEMBLC5Z7V20.0C5Z7V2_SORBI; Putative uncharacterized protein Sb10g027280
STRINGSb10g027280.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.21e-58myb domain protein 101